You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578503 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TMEM16A |
Target | ANO1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TMEM16A |
Protein Sequence | Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY |
UniProt ID | Q5XXA6 |
MW | 111kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | DOG1, TAOS2, ORAOV2, TMEM16A |
Note | For research use only |
NCBI | NP_060513 |
Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Type: Human Liver, Antibody Dilution: 0.2 ug/ml.
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Positive control (+): Human liver (LI), Negative control (-): Human kidney (KI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-TMEM16A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Muscle.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |