You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586404 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ANKS1B |
Target | ANKS1B |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKS1B |
Protein Sequence | Synthetic peptide located within the following region: ACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNI |
UniProt ID | F8VZR9 |
MW | 40kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | EB1, AIDA, EB-1, ANKS2, AIDA-1, cajalin-2 |
Note | For research use only |
NCBI | NP_001190995 |
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-ANKS1B Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell.
ELISA, IF, IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P | |
Bovine, Equine, Human, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |