Anks1 Rabbit Polyclonal Antibody

• Catalog Number: orb325968
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Anks1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 127kDa
• Target: Anks1
• UniProt ID: Q68FS2
• Protein Sequence: Synthetic peptide located within the following region: NLWELELVNVLKVHLLGHRKRIIASLADRPYEEPPQKPPRFSQLRCQDLI
• NCBI: NP_001004275
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Anks1a antibody, anti MGC59413 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Amount and Sample Type: HeLa lysate, Amount of IP Antibody: 10 ug, Primary Antibody: Anks1, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: Anks1.

Lanes: Lane 1: HeLa lysate, Lane 2: rat lung lysate, Lane 3: rat brain lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: Anks1.

WB Suggested Anti-Anks1 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Pancreas.