Anks1 antibody

• Catalog Number: orb325968
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Anks1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 127kDa
• Target: Anks1
• UniProt ID: Q68FS2
• Protein Sequence: Synthetic peptide located within the following region: NLWELELVNVLKVHLLGHRKRIIASLADRPYEEPPQKPPRFSQLRCQDLI
• NCBI: NP_001004275
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Anks1a antibody, anti MGC59413 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of mouse Pancreas tissue using Anks1 antibody

Western blot analysis of human HeLa, rat tissue using Anks1 antibody

Western blot analysis of human HeLa tissue using Anks1 antibody