You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325968 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Anks1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IP, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 127kDa |
Target | Anks1 |
UniProt ID | Q68FS2 |
Protein Sequence | Synthetic peptide located within the following region: NLWELELVNVLKVHLLGHRKRIIASLADRPYEEPPQKPPRFSQLRCQDLI |
NCBI | NP_001004275 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti Anks1a antibody, anti MGC59413 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Amount and Sample Type: HeLa lysate, Amount of IP Antibody: 10 ug, Primary Antibody: Anks1, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: Anks1.
Lanes: Lane 1: HeLa lysate, Lane 2: rat lung lysate, Lane 3: rat brain lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: Anks1.
WB Suggested Anti-Anks1 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Pancreas.
IP, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IP, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
IP, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |