You have no items in your shopping cart.
Animal TNF protein
SKU: orb54150
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Marmota monax (Woodchuck) |
| Tag | N-terminal 6xHis-B2M-tagged |
| Molecular Weight | 34.2 kDa |
| Expression Region | 57-233aa |
| Protein Length | Partial |
| Protein Sequence | GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxins | Not test |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(Cachectin)(TNF-alpha)(Tumor necrosis factor ligand superfamily member 2)(TNF-a)
Similar Products
−
BAY 11-7082 [orb1307179]
99.92% (May vary between batches)
19542-67-7
207.25
C10H9NO2S
5 mg, 25 mg, 1 ml x 10 mM (in DMSO), 500 mg, 100 mg, 200 mg, 10 mg, 50 mg- Item 1 of 1
Animal TNF protein [orb54762]
Greater than 90% as determined by SDS-PAGE.
22.2 kDa
Baculovirus
20 μg, 1 mg, 100 μg Animal TNFA protein [orb633437]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
19.1 KDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mgTH1020 [orb1298682]
99.37% (May vary between batches)
1841460-82-9
453.54
C23H15N7S2
10 mg, 25 mg, 50 mg, 100 mg, 2 mg, 5 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Animal TNF protein (orb54150)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks