Animal TNF protein

SKU: orb54150

Description

Recombinant animal TNF protein

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  N-terminal 10xHis-SUMO-tagged: N-terminal 6xHis-B2M-tagged26-344AA: 57-233AAPartial: Partial

Key Properties

• Source: E.coli
• Biological Origin: Marmota monax (Woodchuck)
• Tag: N-terminal 6xHis-B2M-tagged
• Molecular Weight: 34.2 kDa
• Expression Region: 57-233aa
• Protein Length: Partial
• Protein Sequence: GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Endotoxins: Not test

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

(Cachectin)(TNF-alpha)(Tumor necrosis factor ligand superfamily member 2)(TNF-a)

Quick Database Links

UniProt

O35734