You have no items in your shopping cart.
Animal TNF protein
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Marmota monax (Woodchuck) |
| Tag | N-terminal 6xHis-B2M-tagged |
| Molecular Weight | 34.2 kDa |
| Expression Region | 57-233aa |
| Protein Length | Partial |
| Protein Sequence | GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxins | Not test |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−BAY 11-7082 [orb1307179]
99.92% (May vary between batches)
19542-67-7
207.25
C10H9NO2S
5 mg, 25 mg, 1 ml x 10 mM (in DMSO), 500 mg, 100 mg, 200 mg, 10 mg, 50 mgAnimal TNF protein [orb54762]
Greater than 90% as determined by SDS-PAGE.
22.2 kDa
Baculovirus
20 μg, 1 mg, 100 μgAnimal TNFA protein [orb633437]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
19.1 KDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mgTH1020 [orb1298682]
99.37% (May vary between batches)
1841460-82-9
453.54
C23H15N7S2
10 mg, 25 mg, 50 mg, 100 mg, 2 mg, 5 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Animal TNF protein (orb54150)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
