Cart summary

You have no items in your shopping cart.

ANAPC15 Rabbit Polyclonal Antibody (FITC)

ANAPC15 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088603

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088603
CategoryAntibodies
DescriptionANAPC15 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human ANAPC15
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW13kDa
UniProt IDP60006
Protein SequenceSynthetic peptide located within the following region: EETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDED
NCBINP_054761
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesAPC15, HSPC020, C11orf51
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.