ANAPC15 Rabbit Polyclonal Antibody

• Catalog Number: orb326724
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ANAPC15
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANAPC15
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 14 kDa
• Target: ANAPC15
• UniProt ID: P60006
• Protein Sequence: Synthetic peptide located within the following region: EETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDED
• NCBI: NP_054761
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti APC15 antibody, anti C11orf51 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.

Sample Type: HT1080 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.