ALS2CR12 Rabbit Polyclonal Antibody

• Catalog Number: orb325769
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ALS2CR12
• Target: ALS2CR12
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALS2CR12
• Protein Sequence: Synthetic peptide located within the following region: SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP
• UniProt ID: Q96Q35
• MW: 52 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ALS2CR12
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_631902

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-ALS2CR12 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate.