ALDH3A2 Rabbit Polyclonal Antibody

• Catalog Number: orb330379
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ALDH3A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALDH3A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: ALDH3A2
• UniProt ID: P51648
• Protein Sequence: Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR
• NCBI: NP_001026976
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ALDH10 antibody, anti DKFZp686E23276 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-ALDH3A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: NCI-H226 cell lysate.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-ALDH3A2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adult Adrenal, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec.

WB Suggested Anti-ALDH3A2 Antibody, Positive Control: Lane 1: 30 ug human primary hepatocytes, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000.