ALDH3A2 antibody

• Catalog Number: orb330379
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ALDH3A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALDH3A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: ALDH3A2
• UniProt ID: P51648
• Protein Sequence: Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR
• NCBI: NP_001026976
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ALDH10 antibody, anti DKFZp686E23276 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of NCI-H226 cell lysate tissue using ALDH3A2 antibody

Western blot analysis of human primary hepatocytes tissue using ALDH3A2 antibody

Western blot analysis of human Fetal Lung tissue using ALDH3A2 antibody

Western blot analysis of human Fetal Liver tissue using ALDH3A2 antibody