You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582296 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ALAS1 |
Target | ALAS1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ALAS1 |
Protein Sequence | Synthetic peptide located within the following region: ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS |
UniProt ID | P13196 |
MW | 71 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ALAS, MIG4, ALAS3, ALASH, ALAS-H |
Note | For research use only |
NCBI | NP_000679 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Positive control (+): Human liver (LI), Negative control (-): HepG2 (HG), Antibody concentration: 0.5 ug/ml.
Rabbit Anti-ALAS1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Liver, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-ALAS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Canine, Equine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-Fr, IHC-P | |
Canine, Equine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
AP |
IF, IHC-Fr, IHC-P | |
Canine, Equine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |