You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582500 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AKR7A3 |
Target | AKR7A3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AKR7A3 |
Protein Sequence | Synthetic peptide located within the following region: VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW |
UniProt ID | O95154 |
MW | 37kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | AFAR2 |
Note | For research use only |
NCBI | NP_036199 |
WB Suggested Anti-AKR7A3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Transfected 293T.
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |