You have no items in your shopping cart.
DXYS155E Rabbit Polyclonal Antibody
SKU: orb324519
Description
Research Area
Epigenetics & Chromatin, Immunology & Inflammation, Protein Biochemistry
Images & Validation
−Item 1 of 2
| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Canine, Equine, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DXYS155E |
| Target | AKAP17A |
| Protein Sequence | Synthetic peptide located within the following region: NWEVMERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLD |
| Molecular Weight | 81kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti XE7 antibody, anti 721P antibody, anti XE7Y antibody, anti CCDC133 antibody, anti CXYorf3 antibody, anti PRKA17A antibody, anti SFRS17A antibody, anti AKAP-17A antibody, anti DXYS155E antibody
Similar Products
−A-kinase anchoring protein 17A Antibody [orb556014]
IHC-P, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μlAKAP17A Rabbit Polyclonal Antibody [orb214772]
WB
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 30 μl, 100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human kidney

WB Suggested Anti-DXYS155E Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC
Immunohistochemistry
DXYS155E Rabbit Polyclonal Antibody (orb324519)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




