AKAP10 Rabbit Polyclonal Antibody

• Catalog Number: orb329866
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AKAP10
• Target: AKAP10
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AKAP10
• Protein Sequence: Synthetic peptide located within the following region: ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ
• UniProt ID: O43572
• MW: 71kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti D-AKAP2 antibody, anti MGC9414 antibody, anti
• Note: For research use only
• NCBI: NP_009133

Sample Type: 293T, Antibody Dilution: 1.0 ug/mL, AKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-AKAP10 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: RPMI 8226 cell lysate.