AIM2 Rabbit Polyclonal Antibody

• Catalog Number: orb330613
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AIM2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Equine, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AIM2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: AIM2
• UniProt ID: O14862
• Protein Sequence: Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL
• NCBI: NP_004824
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti PYHIN4 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Zhang, Xuling et al. Effects of lysophosphatidic acid receptor 5 on NLRC4 inflammasome in brain tissues of transient cerebral ischemia/reperfusion rat Hum Exp Toxicol, 41, (2022)

PubMed: 35230166

WB Suggested Anti-AIM2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Lung.