You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330613 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AIM2 |
Target | AIM2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Equine, Mouse, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AIM2 |
Protein Sequence | Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL |
UniProt ID | O14862 |
MW | 39kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti PYHIN4 antibody |
Note | For research use only |
NCBI | NP_004824 |
Zhang, Xuling et al. Effects of lysophosphatidic acid receptor 5 on NLRC4 inflammasome in brain tissues of transient cerebral ischemia/reperfusion rat Hum Exp Toxicol, 41, (2022)
WB Suggested Anti-AIM2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Lung.
IF, IHC-Fr, IHC-P, WB | |
Human, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |