AICDA Rabbit Polyclonal Antibody

• Catalog Number: orb585580
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AICDA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24 kDa
• Target: AICDA
• UniProt ID: Q9GZX7
• Protein Sequence: Synthetic peptide located within the following region: VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
• NCBI: NP_065712
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AID, ARP2, CDA2, HIGM2, HEL-S-284
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Formalin-Fixed, Paraffin-Embedded (FFPE) human tonsil tissue at an antibody concentration of 10 ug/ml using anti-AICDA Antibody (orb585580).