AGT Rabbit Polyclonal Antibody

SKU: orb333716

Description

AGT Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of AGT. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human AGT. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Mouse, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Neuroscience, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGT
• Target: AGT
• Protein Sequence: Synthetic peptide located within the following region: IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
• Molecular Weight: 53kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Anti-Aangiotensinogen (serpin peptidase inhibitor clade A member 8) antibody, anti-AGT antibody, anti-AI265500 antibody, anti-Alpha 1 antiproteinase antitrypsin antibody, anti-Ang antibody, anti-Ang I antibody, anti-Ang II antibody, anti-Ang III antibody, anti-AngII antibody, anti-Angiotensin I antibody, anti-Angiotensin II antibody, anti-Angiotensin III antibody, anti-Angiotensin-3 antibody, anti-Angiotensinogen (PAT) antibody, anti-Angiotensinogen antibody, anti-ANGT_HUMAN antibody, anti-ANHU antibody, anti-ANRT antibody, anti-AT-2 antibody, anti-AT-II antibody, anti-Des-Asp[1]-angiotensin II antibody, anti-FLJ92595 antibody, anti-FLJ97926 antibody, anti-MGC105326 antibody, anti-PAT antibody, anti-Pre angiotensinogen antibody, anti-Serine (or cysteine) proteinase inhibitor antibody, anti-Serpin A8 antibody, anti-Serpin peptidase inhibitor clade A member 8 antibody, anti-SERPINA8 antibody

Quick Database Links

Gene Symbol

AGT

UniProt

P01019

RefSeq (Protein):NP_000020