Cart summary

You have no items in your shopping cart.

AGT Rabbit Polyclonal Antibody

SKU: orb333716

Description

Rabbit polyclonal antibody to Angiotensinogen

Research Area

Epigenetics & Chromatin, Neuroscience, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityCanine, Equine, Mouse, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AGT
TargetAGT
Protein SequenceSynthetic peptide located within the following region: IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
Molecular Weight53kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-Aangiotensinogen (serpin peptidase inhibitor clade A member 8) antibody, anti-AGT antibody, anti-AI265500 antibody, anti-Alpha 1 antiproteinase antitrypsin antibody, anti-Ang antibody, anti-Ang I antibody, anti-Ang II antibody, anti-Ang III antibody, anti-AngII antibody, anti-Angiotensin I antibody, anti-Angiotensin II antibody, anti-Angiotensin III antibody, anti-Angiotensin-3 antibody, anti-Angiotensinogen (PAT) antibody, anti-Angiotensinogen antibody, anti-ANGT_HUMAN antibody, anti-ANHU antibody, anti-ANRT antibody, anti-AT-2 antibody, anti-AT-II antibody, anti-Des-Asp[1]-angiotensin II antibody, anti-FLJ92595 antibody, anti-FLJ97926 antibody, anti-MGC105326 antibody, anti-PAT antibody, anti-Pre angiotensinogen antibody, anti-Serine (or cysteine) proteinase inhibitor antibody, anti-Serpin A8 antibody, anti-Serpin peptidase inhibitor clade A member 8 antibody, anti-SERPINA8 antibody

Similar Products

  • Angiotensinogen Rabbit Polyclonal Antibody [orb396147]

    ELISA,  IHC-P,  WB

    Canine, Equine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    500 μg, 100 μg
  • angiotensinogen Antibody [orb556118]

    ICC,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Angiotensin II Rabbit Polyclonal Antibody [orb312147]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Human, Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Angiotensinogen/AGT Rabbit Polyclonal Antibody [orb1743974]

    ELISA,  FC,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Angiotensin III Rabbit Polyclonal Antibody [orb312154]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Equine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

AGT Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

AGT Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

AGT Rabbit Polyclonal Antibody

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. AGT is supported by BioGPS gene expression data to be expressed in HepG2.

AGT Rabbit Polyclonal Antibody

WB Suggested Anti-AGT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000020

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

AGT Rabbit Polyclonal Antibody (orb333716)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry