AGT Rabbit Polyclonal Antibody

• Catalog Number: orb333716
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Angiotensinogen
• Target: AGT
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGT
• Protein Sequence: Synthetic peptide located within the following region: IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
• UniProt ID: P01019
• MW: 53kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Anti-Aangiotensinogen (serpin peptidase inhibitor
• Research Area: Epigenetics & Chromatin, Neuroscience, Pharmacolog
• Note: For research use only
• NCBI: NP_000020
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. AGT is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-AGT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.