You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb333716 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Angiotensinogen |
Target | AGT |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Mouse, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AGT |
Protein Sequence | Synthetic peptide located within the following region: IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ |
UniProt ID | P01019 |
MW | 53kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Anti-Aangiotensinogen (serpin peptidase inhibitor Read more... |
Note | For research use only |
NCBI | NP_000020 |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. AGT is supported by BioGPS gene expression data to be expressed in HepG2.
WB Suggested Anti-AGT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.
ICC, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |