You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579236 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AGPAT2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Porcine |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human AGPAT2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 27kDa |
Target | AGPAT2 |
UniProt ID | Q5VUD3 |
Protein Sequence | Synthetic peptide located within the following region: LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA |
NCBI | NP_001012745 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BSCL, BSCL1, LPAAB, 1-AGPAT2, LPAAT-beta Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/ml.
WB Suggested Anti-AGPAT2 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.
IF, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Yeast | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |