You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325155 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AGMO |
Target | AGMO |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM195 |
Protein Sequence | Synthetic peptide located within the following region: VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP |
UniProt ID | Q6ZNB7 |
MW | 51kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti FLJ16237 antibody, anti MGC131748 antibody, a Read more... |
Note | For research use only |
NCBI | NP_001004320 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-TMEM195 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |