You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324870 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AGFG1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HRB |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | AGFG1 |
UniProt ID | P52594 |
Protein Sequence | Synthetic peptide located within the following region: SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN |
NCBI | NP_004495 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MGC116938 antibody, anti MGC116940 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Muscle tissue using AGFG1 antibody
Western blot analysis of HepG2 cell lysate tissue using AGFG1 antibody
Western blot analysis of human Fetal Lung tissue using AGFG1 antibody
Western blot analysis of human Fetal Heart tissue using AGFG1 antibody
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating