You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576541 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Aff3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 62kDa |
Target | Aff3 |
UniProt ID | P51827 |
Protein Sequence | Synthetic peptide located within the following region: TNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQ |
NCBI | NP_034808 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | La, LAF, Laf4, LAF-4, A730046J16, 3222402O04Rik Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Aff3 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Thymus.
WB | |
Canine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |