Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Adrenomedullin(22-52) Peptide

SKU: orb72288

Description

This product is Adrenomedullin(22-52) Peptide. Its protein sequence is TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2. Purification is performed using HPLC.

Research Area

Cardiovascular Disease

Images & Validation

Key Properties

PurificationHPLC
Protein SequenceTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2

Storage & Handling

StorageShipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Form/AppearanceLyophilized
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ADM; ADM precursor; ADML_HUMAN.

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Adrenomedullin(22-52) Peptide (orb72288)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 310.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry