ADIPOR1 Rabbit Polyclonal Antibody

• Catalog Number: orb585607
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ADIPOR1
• Target: ADIPOR1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: FPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
• UniProt ID: Q96A54
• MW: 41 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CGI45, PAQR1, ACDCR1, CGI-45, TESBP1A
• Note: For research use only
• NCBI: NP_057083

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Rabbit Anti-ADIPOR1 Antibody, Catalog Number: orb585607, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue, Observed Staining: Plasma membrane and cytoplasm in follicular cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-ADIPOR1 Antibody, Titration: 1.0 ug/ml, Positive Control: MDA-MB-435S Whole Cell. ADIPOR1 is supported by BioGPS gene expression data to be expressed in MDA-MB435.