ADH4 Rabbit Polyclonal Antibody

SKU: orb578873

Description

Rabbit polyclonal antibody to ADH4

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADH4
• Target: ADH4
• Protein Sequence: Synthetic peptide located within the following region: PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV
• Molecular Weight: 40kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ADH-2, HEL-S-4

Immunohistochemistry with Fetal liver cell lysate tissue at an antibody concentration of 1.25 ug/ml using anti-ADH4 antibody (orb578873).

WB Suggested Anti-ADH4 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

ADH4

UniProt

P08319

RefSeq (Protein):NP_000661