Cart summary

You have no items in your shopping cart.

ADGRE5 Rabbit Polyclonal Antibody (FITC)

ADGRE5 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2093298

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2093298
CategoryAntibodies
DescriptionADGRE5 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Protein SequenceSynthetic peptide located within the following region: NSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLC
UniProt IDP48960
MW84kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesCD97, TM7LN1
NoteFor research use only
NCBINP_001020331