Cart summary

You have no items in your shopping cart.

ADGRE1 Rabbit Polyclonal Antibody (FITC)

ADGRE1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2092518

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2092518
CategoryAntibodies
DescriptionADGRE1 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human EMR1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW2kDa
UniProt IDQ14246
Protein SequenceSynthetic peptide located within the following region: GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG
NCBINP_001965
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesEMR1, TM7LN3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.