ADCK2 Rabbit Polyclonal Antibody

• Catalog Number: orb585542
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ADCK2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ADCK2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 68kDa
• Target: ADCK2
• UniProt ID: Q7Z695
• Protein Sequence: Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI
• NCBI: NP_443085
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AARF
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 1.0 ug/ml. ADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat.

Rabbit Anti-ADCK2 Antibody, Catalog Number: orb585542, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Membrane in bile canaliculi, strong signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: donkey anti-rabbit FITC, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.