ACVR1 Rabbit Polyclonal Antibody

SKU: orb330399

Description

ACVR1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ACVR1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human ACVR1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACVR1
• Target: ACVR1
• Protein Sequence: Synthetic peptide located within the following region: TCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIIL
• Molecular Weight: 57 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ACTRI antibody, anti ACVRLK2 antibody, anti ALK2 antibody, anti FOP antibody, anti SKR1 antibody, anti TSRI antibody, anti ACVR1A antibody

Quick Database Links

Gene Symbol

ACVR1

UniProt

Q04771

RefSeq (Protein):NP_001096