You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330399 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ACVR1 |
| Target | ACVR1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACVR1 |
| Protein Sequence | Synthetic peptide located within the following region: TCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIIL |
| UniProt ID | Q04771 |
| MW | 57 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti ACTRI antibody, anti ACVRLK2 antibody, anti A Read more... |
| Research Area | Cell Biology, Epigenetics & Chromatin, Molecular B Read more... |
| Note | For research use only |
| NCBI | NP_001096 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

Human Muscle

WB Suggested Anti-ACVR1 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.
WB | |
Bovine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Cy7 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review