Cart summary

You have no items in your shopping cart.

ACTH 7-38 peptide

SKU: orb1500039

Description

This product is ACTH 7-38 peptide. Its protein sequence is FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE. Purification is performed using HPLC.

Images & Validation

Key Properties

Protein SequenceFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
PurificationHPLC

Storage & Handling

StorageStore at -20°C.
Form/AppearanceLyophilized
Concentration1mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

ACTH 7-38 peptide (orb1500039)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

0.5 mg
$ 370.00
1 mg
$ 500.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry