You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Target | Melanocortin receptor |
|---|---|
| CAS Number | 68563-24-6 |
| MW | 3659.2 |
| Purity | ≥95% |
| Formula | C167H257N47O46 |
| Protein Sequence | FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLQ |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−ACTH?(7-38) (human) [orb3053969]
>98% (HPLC)
68563-24-6
3659.11
C167H257N47O46
5 mg, 10 mg, 100 mg, 50 mg, 25 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Melanocortin receptor
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
ACTH (7- 38), human (orb2694442)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review