You have no items in your shopping cart.
Cart summary
ACTH (7- 38), human
Catalog Number: orb2694442
| Catalog Number | orb2694442 |
|---|---|
| Category | Proteins |
| Description | ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity. |
| Target | Melanocortin receptor |
| Purity | ≥95% |
| Protein Sequence | FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLQ |
| MW | 3659.2 |
| CAS Number | 68563-24-6 |
| Formula | C167H257N47O46 |
| Note | For research use only |
