ACSL3 Rabbit Polyclonal Antibody

• Catalog Number: orb579793
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACSL3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACSL3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 80 kDa
• Target: ACSL3
• UniProt ID: O95573
• Protein Sequence: Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
• NCBI: NP_004448
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ACS3, FACL3, LACS3, LACS 3, PRO2194
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Positive control (+): MCF7 (N10), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.

Application: IHC, Species+tissue/cell type:THP-1 derived macrophage activated with iMtb, Primary antibody dilution: 1:200, Secondary antibody: Goat anti-rabbit Alexa Fluor 647, Secondary antibody dilution: 1:333.

Application: IHC, Species+tissue/cell type:THP-1 derived macrophage, Primary antibody dilution: 1:200, Secondary antibody: Goat anti-rabbit Alexa Fluor 647, Secondary antibody dilution: 1:333.

WB Suggested Anti-ACSL3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. There is BioGPS gene expression data showing that ACSL3 is expressed in HEK293T.