ACSL3 Rabbit Polyclonal Antibody

SKU: orb579793

Description

Rabbit polyclonal antibody to ACSL3

Research Area

Cell Biology

Images & Validation

−

Item 1 of 5

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ACSL3
Target	ACSL3
Protein Sequence	Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
Molecular Weight	80 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

ACS3, FACL3, LACS3, LACS 3, PRO2194

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Positive control (+): MCF7 (N10), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.

Application: IHC, Species+tissue/cell type:THP-1 derived macrophage activated with iMtb, Primary antibody dilution: 1:200, Secondary antibody: Goat anti-rabbit Alexa Fluor 647, Secondary antibody dilution: 1:333.

Application: IHC, Species+tissue/cell type:THP-1 derived macrophage, Primary antibody dilution: 1:200, Secondary antibody: Goat anti-rabbit Alexa Fluor 647, Secondary antibody dilution: 1:333.

WB Suggested Anti-ACSL3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. There is BioGPS gene expression data showing that ACSL3 is expressed in HEK293T.

Quick Database Links

Gene Symbol

ACSL3

UniProt

O95573

RefSeq (Protein):NP_004448

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_004448

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols