You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584048 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ACRBP |
Target | ACRBP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACRBP |
Protein Sequence | Synthetic peptide located within the following region: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR |
UniProt ID | Q8NEB7 |
MW | 59kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CT23, SP32, OY-TES-1 |
Note | For research use only |
NCBI | NP_115878 |
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |