ACO1 Rabbit Polyclonal Antibody

• Catalog Number: orb330127
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACO1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACO1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 98kDa
• Target: ACO1
• UniProt ID: P28271
• Protein Sequence: Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC
• NCBI: NP_002188
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti IRP1 antibody, anti ACONS antibody, anti IREB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/mL.

Sample Type: Fetal Kidney, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

Lane 1: 100 ug HePG2 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody Dilution: 1:8000, Gene Name: ACO1.

Lanes: 1. 45 ug capan1 cell lysate, 2. 45 ug HPAF cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: ACO1.

Lanes: 1. 60 ug mouse liver extract 2. 60 ug mouse liver extract 3. 60 ug mouse liver extract, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:3000, Gene Name: ACO1.

Rabbit Anti-ACO1 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Sample Type: Human Capan1 cells (Pancreatic cancer cell line), Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-AlexaFluor-488, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: ACO1: Green DAPI: Blue, Gene Name: ACO1.

WB Suggested Anti-ACO1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human kidney.