You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330127 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ACO1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACO1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 98kDa |
Target | ACO1 |
UniProt ID | P28271 |
Protein Sequence | Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
NCBI | NP_002188 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti IRP1 antibody, anti ACONS antibody, anti IREB Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of HePG2 tissue using ACO1 antibody
Western blot analysis of human kidney tissue using ACO1 antibody
Immunohistochemical staining of human Skeletal muscle tissue using ACO1 antibody
Immunohistochemical staining of human Capan1 tissue using ACO1 antibody
Western blot analysis of mouse liver tissue using ACO1 antibody
Western blot analysis of human capan1, HPAF tissue using ACO1 antibody
ELISA, FC, ICC, IF, IHC, WB | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating