Cart summary

You have no items in your shopping cart.

ACO1 Rabbit Polyclonal Antibody

SKU: orb330127

Description

Rabbit polyclonal antibody to ACO1

Research Area

Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ACO1
TargetACO1
Protein SequenceSynthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC
Molecular Weight98kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti IRP1 antibody, anti ACONS antibody, anti IREB1 antibody, anti IREBP antibody, anti IREBP1 antibody

Similar Products

  • Aconitase 1/ACO1 Rabbit Polyclonal Antibody [orb654400]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • IRP-1 (phospho Ser711) rabbit pAb Antibody [orb769263]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • IRP-1 (phospho Ser138) rabbit pAb Antibody [orb769264]

    ELISA,  IF,  IHC

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • ACO1 Rabbit Polyclonal Antibody [orb624444]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Aconitase 1 Rabbit Polyclonal Antibody [orb1192]

    WB

    Bovine, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ACO1 Rabbit Polyclonal Antibody

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/mL.

ACO1 Rabbit Polyclonal Antibody

Sample Type: Fetal Kidney, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

ACO1 Rabbit Polyclonal Antibody

Lane 1: 100 ug HePG2 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody Dilution: 1:8000, Gene Name: ACO1.

ACO1 Rabbit Polyclonal Antibody

Lanes: 1. 45 ug capan1 cell lysate, 2. 45 ug HPAF cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: ACO1.

ACO1 Rabbit Polyclonal Antibody

Lanes: 1. 60 ug mouse liver extract 2. 60 ug mouse liver extract 3. 60 ug mouse liver extract, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:3000, Gene Name: ACO1.

ACO1 Rabbit Polyclonal Antibody

Rabbit Anti-ACO1 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

ACO1 Rabbit Polyclonal Antibody

Sample Type: Human Capan1 cells (Pancreatic cancer cell line), Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-AlexaFluor-488, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: ACO1: Green DAPI: Blue, Gene Name: ACO1.

ACO1 Rabbit Polyclonal Antibody

WB Suggested Anti-ACO1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human kidney.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002188

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ACO1 Rabbit Polyclonal Antibody (orb330127)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry