ACADVL antibody

• Catalog Number: orb330756
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACADVL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACADVL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: ACADVL
• UniProt ID: P49748
• Protein Sequence: Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
• NCBI: NP_001029031
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ACAD6 antibody, anti LCACD antibody, anti VLC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Pineal tissue using ACADVL antibody

Western blot analysis of Recombinant protein tissue using ACADVL antibody

Western blot analysis of HepG2 cell lysate tissue using ACADVL antibody