ACAA1 Rabbit Polyclonal Antibody

• Catalog Number: orb580316
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACAA1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACAA1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44kDa
• Target: ACAA1
• UniProt ID: P09110
• Protein Sequence: Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
• NCBI: NP_001598
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ACAA, THIO, PTHIO
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ACAA1 antibody - N-terminal region (orb580316) validated by WB using Human Liver cell lysate at 1:1000.

ACAA1 antibody - N-terminal region (orb580316), Catalog Number: orb580316, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in granules of hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Immunohistochemistry with Human Liver cell lysate tissue.

Rat purified peroxisomes.