You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325987 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FAM175B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KIAA0157 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | ABRAXAS2 |
UniProt ID | Q15018 |
Protein Sequence | Synthetic peptide located within the following region: GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI |
NCBI | NP_115558 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ABRO1 antibody, anti FLJ22338 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
FAM175B was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb325987 with 1:200 dilution. Western blot was performed using orb325987 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FAM175B IP with orb325987 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-KIAA0157 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, FAM175B is supported by BioGPS gene expression data to be expressed in HepG2.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |