ABRAXAS2 Rabbit Polyclonal Antibody

• Catalog Number: orb325987
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAM175B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0157
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: ABRAXAS2
• UniProt ID: Q15018
• Protein Sequence: Synthetic peptide located within the following region: GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI
• NCBI: NP_115558
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ABRO1 antibody, anti FLJ22338 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

FAM175B was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb325987 with 1:200 dilution. Western blot was performed using orb325987 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FAM175B IP with orb325987 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-KIAA0157 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, FAM175B is supported by BioGPS gene expression data to be expressed in HepG2.