Cart summary

You have no items in your shopping cart.

Abo Rabbit Polyclonal Antibody (HRP)

Abo Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2113010

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2113010
CategoryAntibodies
DescriptionAbo Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman, Rat
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW39kDa
UniProt IDP38649
Protein SequenceSynthetic peptide located within the following region: GVEILSTFFGTLHPGFYSSSREAFTYERRPQSQAYIPWDRGDFYYGGAFF
NCBINP_109643
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesNAGAT
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.