You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb586919 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ABHD14A |
| Target | ABHD14A |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Porcine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human ABHD14A |
| Protein Sequence | Synthetic peptide located within the following region: DLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALP |
| UniProt ID | Q9BUJ0 |
| MW | 30kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | DORZ1 |
| Research Area | Neuroscience, Stem Cell & Developmental Biology |
| Note | For research use only |
| NCBI | NP_056222 |

Sample Type: Fetal Kidney lysates, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-ABHD14A Antibody, Catalog Number: orb586919, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, weak signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review