ABHD14A Rabbit Polyclonal Antibody

• Catalog Number: orb586920
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ABHD14A
• Target: ABHD14A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ABHD14A
• Protein Sequence: Synthetic peptide located within the following region: IAPTSTQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVK
• UniProt ID: Q9BUJ0
• MW: 30kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DORZ1
• Research Area: Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_056222

Sample Type: 293T Whole Cell lysates, Antibody dilution: 1.0 ug/ml. ABHD14A is supported by BioGPS gene expression data to be expressed in HEK293T.

Rabbit Anti-ABHD14A Antibody, Catalog Number: orb586920, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.