You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330324 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ABCD3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ABCD3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 75kDa |
Target | ABCD3 |
UniProt ID | P28288 |
Protein Sequence | Synthetic peptide located within the following region: LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD |
NCBI | NP_002849 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ABC43 antibody, anti PMP70 antibody, anti PXM Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Human 721_B, Antibody Dilution: 1.0 ug/mL, ABCD3 is supported by BioGPS gene expression data to be expressed in 721_B.
Sample Type: Human Hela, Antibody Dilution: 1.0 ug/mL, ABCD3 is supported by BioGPS gene expression data to be expressed in HeLa.
Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/mL, ABCD3 is supported by BioGPS gene expression data to be expressed in HepG2.
WB Suggested Anti-ABCD3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |