ABCC8 Rabbit Polyclonal Antibody

• Catalog Number: orb330321
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ABCC8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABCC8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 177kDa
• Target: ABCC8
• UniProt ID: Q09428
• Protein Sequence: Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
• NCBI: NP_000343
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ABC36 antibody, anti HHF1 antibody, anti HI a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Small intestine

WB Suggested Anti-ABCC8 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.