ABCA5 Rabbit Polyclonal Antibody

• Catalog Number: orb330336
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ABCA5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ABCA5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 186kDa
• Target: ABCA5
• UniProt ID: Q8WWZ7
• Protein Sequence: Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI
• NCBI: NP_061142
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ABC13 antibody, anti DKFZp451F117 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Human Colon lysate tissue at an antibody concentration of 5.0 ug/mL using anti-ABCA5 antibody (orb330336).

WB Suggested Anti-ABCA5 Antibody Titration: 1 ug/mL, Positive Control: MCF-7 whole cell lysates.