Abca1 Rabbit Polyclonal Antibody

• Catalog Number: orb578901
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Abca1
• Target: Abca1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK
• UniProt ID: B1AWZ8
• MW: 254kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ABC, Abc1, ABC-1
• Note: For research use only
• NCBI: NP_038482

Sample Tissue: Mouse Mouse Liver, Antibody Dilution: 3 ug/ml.

WB Suggested Anti-Abca1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Mouse Kidney.