You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578901 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Abca1 |
Target | Abca1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Protein Sequence | Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK |
UniProt ID | B1AWZ8 |
MW | 254kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ABC, Abc1, ABC-1 |
Note | For research use only |
NCBI | NP_038482 |
Sample Tissue: Mouse Mouse Liver, Antibody Dilution: 3 ug/ml.
WB Suggested Anti-Abca1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Mouse Kidney.
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |