You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573938 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AATF |
Target | AATF |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Mouse, Rabbit, Rat, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AATF |
Protein Sequence | Synthetic peptide located within the following region: EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE |
UniProt ID | Q9NY61 |
MW | 63kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | DED, BFR2, CHE1, CHE-1 |
Note | For research use only |
NCBI | NP_036270 |
Human Intestine
Human Liver
WB Suggested Anti-AATF Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human kidney.
IF, IH, WB | |
Human, Primate | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |