AADAT Rabbit Polyclonal Antibody

• Catalog Number: orb330311
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AADAT
• Target: AADAT
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AADAT
• Protein Sequence: Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI
• UniProt ID: Q8N5Z0
• MW: 47 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti KAT2 antibody, anti KATII antibody
• Note: For research use only
• NCBI: NP_057312

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein is processed to mature 44 kDa and the protein may be modified by succinyl lysine at several residues.

Human kidney

WB Suggested Anti-AADAT Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate.