Cart summary

You have no items in your shopping cart.

AADAT Rabbit Polyclonal Antibody (HRP)

AADAT Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2120570

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2120570
CategoryAntibodies
DescriptionAADAT Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human AADAT
Protein SequenceSynthetic peptide located within the following region: EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI
UniProt IDQ8N5Z0
MW47kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesKAT2, KATII, KYAT2
NoteFor research use only
NCBINP_057312
  • AADAT Rabbit Polyclonal Antibody (HRP) [orb2120573]

    IHC,  WB

    Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl