A1BG Rabbit Polyclonal Antibody

• Catalog Number: orb574834
• Category: Antibodies
• Description: Rabbit polyclonal antibody to A1BG
• Target: A1BG
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
• Protein Sequence: Synthetic peptide located within the following region: ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG
• UniProt ID: P04217
• MW: 54 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: A1B, ABG, GAB, HYST2477
• Research Area: Signal Transduction
• Note: For research use only
• NCBI: NP_570602

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Recommended dilution is 1-3 ug/ml. Protein is processed from 54 kDa to 52 kDa.

WB Suggested Anti-A1BG Antibody, Titration: 5 ug/ml, Positive Control: human liver, human serum, human plasma.

WB Suggested Anti-A1BG Antibody Titration: 0.1 ug/ml Positive Control: Fetal Liver.

WB Suggested Anti-A1BG Antibody, Titration: 1.25 ug/ml, Positive Control: HepG2 Whole Cell.