A1BG Rabbit Polyclonal Antibody

SKU: orb574834

Description

Rabbit polyclonal antibody to A1BG

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
• Target: A1BG
• Protein Sequence: Synthetic peptide located within the following region: ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG
• Molecular Weight: 54 kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

A1B, ABG, GAB, HYST2477

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Recommended dilution is 1-3 ug/ml. Protein is processed from 54 kDa to 52 kDa.

WB Suggested Anti-A1BG Antibody, Titration: 5 ug/ml, Positive Control: human liver, human serum, human plasma.

WB Suggested Anti-A1BG Antibody Titration: 0.1 ug/ml Positive Control: Fetal Liver.

WB Suggested Anti-A1BG Antibody, Titration: 1.25 ug/ml, Positive Control: HepG2 Whole Cell.

Quick Database Links

Gene Symbol

A1BG

UniProt

P04217

RefSeq (Protein):NP_570602