You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574834 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to A1BG |
| Target | A1BG |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG |
| Protein Sequence | Synthetic peptide located within the following region: ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG |
| UniProt ID | P04217 |
| MW | 54 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | A1B, ABG, GAB, HYST2477 |
| Research Area | Signal Transduction |
| Note | For research use only |
| NCBI | NP_570602 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Recommended dilution is 1-3 ug/ml. Protein is processed from 54 kDa to 52 kDa.

WB Suggested Anti-A1BG Antibody, Titration: 5 ug/ml, Positive Control: human liver, human serum, human plasma.

WB Suggested Anti-A1BG Antibody Titration: 0.1 ug/ml Positive Control: Fetal Liver.

WB Suggested Anti-A1BG Antibody, Titration: 1.25 ug/ml, Positive Control: HepG2 Whole Cell.
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review