A1BG Rabbit Polyclonal Antibody

• Catalog Number: orb574833
• Category: Antibodies
• Description: Rabbit polyclonal antibody to A1BG
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: A1BG
• UniProt ID: P04217
• Protein Sequence: Synthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
• NCBI: NP_570602
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: A1B, ABG, GAB, HYST2477
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. A1BG s supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. A1BG is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. A1BG is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-A1BG Antibody, Titration: 0.1 ug/ml, Positive Control: Fetal Liver.

WB Suggested Anti-A1BG Antibody, Titration: 5 ug/ml, Positive Control: human liver, human serum, human plasma.

WB Suggested Anti-A1BG Antibody, Titration: 1.25 ug/ml, Positive Control: HepG2 Whole Cell. A1BG is supported by BioGPS gene expression data to be expressed in HepG2.