C14ORF131 Rabbit Polyclonal Antibody

• Catalog Number: orb324438
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF839
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C14ORF131
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: ZNF839
• UniProt ID: Q9Y595
• Protein Sequence: Synthetic peptide located within the following region: KMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHL
• NCBI: NP_060805
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti C14orf131 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-C14ORF131 Antibody Titration: 0.3-0.5 ug/mL, Positive Control: HepG2 cell lysate, ZNF839 is supported by BioGPS gene expression data to be expressed in HepG2.