You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577338 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF786 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF786 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 13kDa |
Target | ZNF786 |
UniProt ID | Q8N393 |
Protein Sequence | Synthetic peptide located within the following region: MAEPPRLPLTFEDVAIYFSEQEWQDLEAWQKELYKHVMRSNYETLVSLDD |
NCBI | EAW80063 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Lung
WB Suggested Anti-ZNF786 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |