ZNF687 Rabbit Polyclonal Antibody

SKU: orb577118

Description

Rabbit polyclonal antibody to ZNF687

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF687
• Target: ZNF687
• Protein Sequence: Synthetic peptide located within the following region: DSPLPASGGPLTCKVCGKSCDSPLNLKTHFRTHGMAFIRARQGAVGDN
• Molecular Weight: 130 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PDB6

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation and phosphorylation.

Sample Tissue: Human A172 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.

WB Suggested Anti-ZNF687 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 293T cell lysate.

Quick Database Links

Gene Symbol

ZNF687

UniProt

Q8N1G0

RefSeq (Protein):NP_065883