You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577118 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF687 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF687 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 130 kDa |
Target | ZNF687 |
UniProt ID | Q8N1G0 |
Protein Sequence | Synthetic peptide located within the following region: DSPLPASGGPLTCKVCGKSCDSPLNLKTHFRTHGMAFIRARQGAVGDN |
NCBI | NP_065883 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PDB6 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation and phosphorylation.
Sample Tissue: Human A172 Whole Cell, Antibody Dilution: 1 ug/ml.
Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.
WB Suggested Anti-ZNF687 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 293T cell lysate.
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |