Cart summary

You have no items in your shopping cart.

ZNF490 Rabbit Polyclonal Antibody (HRP)

ZNF490 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2127431

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2127431
CategoryAntibodies
DescriptionZNF490 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZNF490
Protein SequenceSynthetic peptide located within the following region: RRNSSLSFQMERPLEEQVQSKWSSSQGRTGTGGSDVLQMQNSEHHGQSIK
UniProt IDQ9ULM2
MW61kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesKIAA1198
NoteFor research use only
NCBINP_065765
Expiration Date12 months from date of receipt.